(data stored in ACNUC7421 zone)

EMBL: CP000272.PE83

CP000272.PE83        Location/Qualifiers
FT   CDS             complement(96282..97133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0085"
FT                   /product="ABC taurine family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36011"
FT                   /db_xref="GOA:Q13IS8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS8"
FT                   /protein_id="ABE36011.1"
FT                   /translation="MSSIDSLPSSPAGRRAAGRRKPRRGLPGEGPTAILSVASVVAIAA
FT                   LWWAATSFHWVPPLFLPAPQAVWSAFVDAWNGRIQGGLPLCQHLMWSAIRVFGAFALAS
FT                   VTAVPVGILMGVSRIARGLLDPPLEFYRPLPPLAYLPLVVIWFGIDETAKLIVIYLACF
FT                   APIAMAARAGVRSATAEQVNAAYSLGASFAQVVRHVVLPAALPEILTGLRIAIGFGWTT
FT                   LVAAEMVAATAGLGQMVLNASSFLRTDVVVMGIVLIGLIAWTFDLGMRALERRLVPWRG
FT                   KA"
     MSSIDSLPSS PAGRRAAGRR KPRRGLPGEG PTAILSVASV VAIAALWWAA TSFHWVPPLF        60
     LPAPQAVWSA FVDAWNGRIQ GGLPLCQHLM WSAIRVFGAF ALASVTAVPV GILMGVSRIA       120
     RGLLDPPLEF YRPLPPLAYL PLVVIWFGID ETAKLIVIYL ACFAPIAMAA RAGVRSATAE       180
     QVNAAYSLGA SFAQVVRHVV LPAALPEILT GLRIAIGFGW TTLVAAEMVA ATAGLGQMVL       240
     NASSFLRTDV VVMGIVLIGL IAWTFDLGMR ALERRLVPWR GKA                         283
//

If you have problems or comments...

PBIL Back to PBIL home page