(data stored in ACNUC7421 zone)

EMBL: CP000272.PE85

CP000272.PE85        Location/Qualifiers
FT   CDS             complement(97921..98943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0087"
FT                   /product="ABC taurine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36013"
FT                   /db_xref="GOA:Q13IS6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS6"
FT                   /protein_id="ABE36013.1"
FT                   /translation="MKPLLSSLRTAAAGLTLFTLMAGAVHAESREVVIGYQDMVVPWRY
FT                   AQVSGAVEKATGYKVTYRKLAGGADVIRALASGSIQLGEAGSSPIAAGLSQGVDISLFW
FT                   ILDNINDAEALVARNGSGVTKLTDLKGRKIGLPFVSTSHFHALVALQDAGVDPSTVKIL
FT                   NLRPPEVAAAWERGDIDATYIWDPVLAKVKKNGKVLITSGEVARESGKATFDGFAVNRK
FT                   FAQDNGAFLVGLVKVLADTDAQYRDHKAAWTVGSKEVEGVAQESGANAADVPASLALYA
FT                   FPTLAEQASPTWLGGGAQSGAAKSLAATAAFLKSQGTIQNVLPDYSAGVDPRFVQQAAK
FT                   "
     MKPLLSSLRT AAAGLTLFTL MAGAVHAESR EVVIGYQDMV VPWRYAQVSG AVEKATGYKV        60
     TYRKLAGGAD VIRALASGSI QLGEAGSSPI AAGLSQGVDI SLFWILDNIN DAEALVARNG       120
     SGVTKLTDLK GRKIGLPFVS TSHFHALVAL QDAGVDPSTV KILNLRPPEV AAAWERGDID       180
     ATYIWDPVLA KVKKNGKVLI TSGEVARESG KATFDGFAVN RKFAQDNGAF LVGLVKVLAD       240
     TDAQYRDHKA AWTVGSKEVE GVAQESGANA ADVPASLALY AFPTLAEQAS PTWLGGGAQS       300
     GAAKSLAATA AFLKSQGTIQ NVLPDYSAGV DPRFVQQAAK                             340
//

If you have problems or comments...

PBIL Back to PBIL home page