(data stored in ACNUC7421 zone)

EMBL: CP000272.PE86

CP000272.PE86        Location/Qualifiers
FT   CDS             99417..100823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0088"
FT                   /product="Putative selenium binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36014"
FT                   /db_xref="GOA:Q13IS5"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS5"
FT                   /protein_id="ABE36014.1"
FT                   /translation="MGMRPDPTFHASPKLAMDAPAENYAYTLLLSPDFSQPDALAVIDV
FT                   KPGSPTYSKVVHTVPVPNKGDEFHHFGWNACSSALSPLTGHAFLERRYLIIPGMRSSRI
FT                   YIVDTKPHPTQARLHKIIEPEEIFRKTGYSRPHTVHCGPEGIYVSTLGGGGKEGTDGPP
FT                   GIFIMDCETFEVLGRWEIDRGPQEKHYDFWWNLPRDYMVSSEWALPPQFENGIVAEDLL
FT                   SNRYGHHIHFWDLRARRNVQSIDLGANHQMALEVRPAHDPSREYGFIGVVVDTTNLEGS
FT                   IWTWWREGGQFHIEKTATIPPEPAAAELLPPLLQGFGAVPPLVTDIDLSIDDKFLYVAC
FT                   WGTGEMRQYDVTDPRKPKLAGSVHIGGIARRTPHPNGETFAGGPQMVEISRDGKRVYWT
FT                   NSLYSSWDNQFYPNGVPAAQVMARAEPGGGLTLADDYWVAFPDGYRAHQIRLEGGDCST
FT                   DSFCYPSVGI"
     MGMRPDPTFH ASPKLAMDAP AENYAYTLLL SPDFSQPDAL AVIDVKPGSP TYSKVVHTVP        60
     VPNKGDEFHH FGWNACSSAL SPLTGHAFLE RRYLIIPGMR SSRIYIVDTK PHPTQARLHK       120
     IIEPEEIFRK TGYSRPHTVH CGPEGIYVST LGGGGKEGTD GPPGIFIMDC ETFEVLGRWE       180
     IDRGPQEKHY DFWWNLPRDY MVSSEWALPP QFENGIVAED LLSNRYGHHI HFWDLRARRN       240
     VQSIDLGANH QMALEVRPAH DPSREYGFIG VVVDTTNLEG SIWTWWREGG QFHIEKTATI       300
     PPEPAAAELL PPLLQGFGAV PPLVTDIDLS IDDKFLYVAC WGTGEMRQYD VTDPRKPKLA       360
     GSVHIGGIAR RTPHPNGETF AGGPQMVEIS RDGKRVYWTN SLYSSWDNQF YPNGVPAAQV       420
     MARAEPGGGL TLADDYWVAF PDGYRAHQIR LEGGDCSTDS FCYPSVGI                    468
//

If you have problems or comments...

PBIL Back to PBIL home page