(data stored in ACNUC7421 zone)

EMBL: CP000272.PE87

CP000272.PE87        Location/Qualifiers
FT   CDS             100820..101497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0089"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36015"
FT                   /db_xref="GOA:Q13IS4"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS4"
FT                   /protein_id="ABE36015.1"
FT                   /translation="MTGGGWSQTGLWLAVLASGLYHGVNPAMGWPLAVSSGLMQRRVRA
FT                   LVVALFYLAAGHVLAMFVVMLPFAMLAILLAWQREIQLGASVLVAGFGAFLLICRRHPR
FT                   VLARIPPGRLALWSFAVAIAHGAGLMLVPVYLGLCRAYRMDRAHQAAQSLIDADLRMAL
FT                   FVSAAHATAMIAAGGLLAWLVYRYLGLKFVSRSWFNLDAIWASSLILVGMLSLAVNAAA
FT                   PVG"
     MTGGGWSQTG LWLAVLASGL YHGVNPAMGW PLAVSSGLMQ RRVRALVVAL FYLAAGHVLA        60
     MFVVMLPFAM LAILLAWQRE IQLGASVLVA GFGAFLLICR RHPRVLARIP PGRLALWSFA       120
     VAIAHGAGLM LVPVYLGLCR AYRMDRAHQA AQSLIDADLR MALFVSAAHA TAMIAAGGLL       180
     AWLVYRYLGL KFVSRSWFNL DAIWASSLIL VGMLSLAVNA AAPVG                       225
//

If you have problems or comments...

PBIL Back to PBIL home page