(data stored in ACNUC7421 zone)

EMBL: CP000272.PE88

CP000272.PE88        Location/Qualifiers
FT   CDS             complement(101700..102887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0090"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36016"
FT                   /db_xref="GOA:Q13IS3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IS3"
FT                   /protein_id="ABE36016.1"
FT                   /translation="MSVPSRQRPSFLRRKLLGTAVALALGGIASIAPAAAPASGEPVLF
FT                   GVSGPLSGPNAQYGAQWKAGFDLALDQINRDGGIHGRPLQYVFEDSQSDPRQAVTIAQK
FT                   FVGDPRILIELGDFSSPASMAASPIYQRAGLVQLGFTNSHPDFTKGGDFIWSPSVSQAD
FT                   AQPLLAELAAKQGFKRVAVLYQNTDWGRASKDVFVKAAASRGIQVVASEGYQPTDKDFR
FT                   ATLLRLRDANPDALVLISYYSDGAQIVRQARGSGLHTPIVAASSVYSPKFMELGGDAVN
FT                   GVTTNTSFFPDDPRPEVQHFVRTFEAKYHQQPDAFNAFAYDAAIIAAYALRAGGLDRRG
FT                   VRDALPRLRDVPSVVFGRATFDPATRRVIGVRSVNLVVDHGRWVLLSAKSSLAAK"
     MSVPSRQRPS FLRRKLLGTA VALALGGIAS IAPAAAPASG EPVLFGVSGP LSGPNAQYGA        60
     QWKAGFDLAL DQINRDGGIH GRPLQYVFED SQSDPRQAVT IAQKFVGDPR ILIELGDFSS       120
     PASMAASPIY QRAGLVQLGF TNSHPDFTKG GDFIWSPSVS QADAQPLLAE LAAKQGFKRV       180
     AVLYQNTDWG RASKDVFVKA AASRGIQVVA SEGYQPTDKD FRATLLRLRD ANPDALVLIS       240
     YYSDGAQIVR QARGSGLHTP IVAASSVYSP KFMELGGDAV NGVTTNTSFF PDDPRPEVQH       300
     FVRTFEAKYH QQPDAFNAFA YDAAIIAAYA LRAGGLDRRG VRDALPRLRD VPSVVFGRAT       360
     FDPATRRVIG VRSVNLVVDH GRWVLLSAKS SLAAK                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page