(data stored in ACNUC7421 zone)

EMBL: CP000272.PE95

CP000272.PE95        Location/Qualifiers
FT   CDS             110102..111010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0097"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36023"
FT                   /db_xref="GOA:Q13IR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR6"
FT                   /protein_id="ABE36023.1"
FT                   /translation="MNPASVSGRDILFDVRRVTRRFDGLTAVDGVSLSVARGECVSVIG
FT                   PNGAGKSTLFNLLTGMDVPDEGEIRLDGEDVTGTSPERLAARGVARTFQHGRVFGNLSV
FT                   LDNVLIGAHSRLALARPGWPVLGAFSEVVRALVRPSALRREEAALRADAEAIIARFGTR
FT                   LTPRIEQPAHSLSYANRRRVEIARALALRPRMLLLDEPTAGMNESETAEMLELILDLKR
FT                   DGLTILLIEHKLDLVMRLSDRVIVLDDGRKIAAGLPDAVRNDPAVIDAYLGHRHVGAQA
FT                   GPAAQAVAARSDSTVTGAQHA"
     MNPASVSGRD ILFDVRRVTR RFDGLTAVDG VSLSVARGEC VSVIGPNGAG KSTLFNLLTG        60
     MDVPDEGEIR LDGEDVTGTS PERLAARGVA RTFQHGRVFG NLSVLDNVLI GAHSRLALAR       120
     PGWPVLGAFS EVVRALVRPS ALRREEAALR ADAEAIIARF GTRLTPRIEQ PAHSLSYANR       180
     RRVEIARALA LRPRMLLLDE PTAGMNESET AEMLELILDL KRDGLTILLI EHKLDLVMRL       240
     SDRVIVLDDG RKIAAGLPDA VRNDPAVIDA YLGHRHVGAQ AGPAAQAVAA RSDSTVTGAQ       300
     HA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page