(data stored in ACNUC7421 zone)

EMBL: CP000272.PE97

CP000272.PE97        Location/Qualifiers
FT   CDS             complement(111916..112749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0099"
FT                   /product="ABC nitrate/nitrite/cyanate family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36025"
FT                   /db_xref="GOA:Q13IR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IR4"
FT                   /protein_id="ABE36025.1"
FT                   /translation="MSSVTGRPAATPRDSNAAAGGPRIVSGWLARTLLGLTGLAGIVAI
FT                   WWLAIHLIARPDSLAAQFSPGRALAALPSLVTEDRLLVHIATSLRRIAIGLAWALLIGV
FT                   PLGFLIGRIKAFDTALSPTLQFLRMISPLSWMPIAVMSLGVGDRAVYFLLAFAAVWPLV
FT                   MSTAAGVTQIDRRWLQLAESLAATRGEMLWHIFVPGLAAHVLTGVRLAIGILWIVLVPA
FT                   EMLGVSSGLGYLILDTRDRLAYSELTAVILVIGALGFLLDYAARLIYRRCGYEQR"
     MSSVTGRPAA TPRDSNAAAG GPRIVSGWLA RTLLGLTGLA GIVAIWWLAI HLIARPDSLA        60
     AQFSPGRALA ALPSLVTEDR LLVHIATSLR RIAIGLAWAL LIGVPLGFLI GRIKAFDTAL       120
     SPTLQFLRMI SPLSWMPIAV MSLGVGDRAV YFLLAFAAVW PLVMSTAAGV TQIDRRWLQL       180
     AESLAATRGE MLWHIFVPGL AAHVLTGVRL AIGILWIVLV PAEMLGVSSG LGYLILDTRD       240
     RLAYSELTAV ILVIGALGFL LDYAARLIYR RCGYEQR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page