(data stored in ACNUC7421 zone)

EMBL: CP000283.PE1

CP000283.PE1         Location/Qualifiers
FT   CDS             649..2067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37241"
FT                   /db_xref="GOA:Q13F98"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13F98"
FT                   /protein_id="ABE37241.1"
FT                   /translation="MSNMEHDRWSRVKGRLRSSVGEDVYSSWFARMDLEAVQQESVHLS
FT                   VPTRFLKSWIQTHYSEKVLTCWQAEMPEVCRIDLTVRSPMRAAVTKEAPAPAEHRRDEH
FT                   RPAADARSHAAAPAPSNHDALGGSPLDPRLTFASFVVGRSNTLAHAAAKQVAEGRRGDP
FT                   VMFNPLYIHSGVGLGKTHLLQAVTWAGNSGTERKVLYLTAEKFMYGFVASLKTQTSLAF
FT                   KEALRGIDVLVIDDLQFLQGKTTQAEFCHTLNALIDAGRQVVVAADRPPADLESLDERV
FT                   RSRLAGGLVVEMAPLGEELRLGILKSRVVAARTHHASFDVPQSVLEYLARAITHNGRDL
FT                   EGAINRLLAHSKLNAQPVTLEMAEHEVRDLIRPQEPKRIKIEDIQRVVARQYNVSRSDL
FT                   LSSRRTANVVRPRQVAMYLAKTLTLRSLPEIGRRFGGRDHTTVLHAVRKIEGLVSKDVT
FT                   LSDEVESLKRQLQE"
     MSNMEHDRWS RVKGRLRSSV GEDVYSSWFA RMDLEAVQQE SVHLSVPTRF LKSWIQTHYS        60
     EKVLTCWQAE MPEVCRIDLT VRSPMRAAVT KEAPAPAEHR RDEHRPAADA RSHAAAPAPS       120
     NHDALGGSPL DPRLTFASFV VGRSNTLAHA AAKQVAEGRR GDPVMFNPLY IHSGVGLGKT       180
     HLLQAVTWAG NSGTERKVLY LTAEKFMYGF VASLKTQTSL AFKEALRGID VLVIDDLQFL       240
     QGKTTQAEFC HTLNALIDAG RQVVVAADRP PADLESLDER VRSRLAGGLV VEMAPLGEEL       300
     RLGILKSRVV AARTHHASFD VPQSVLEYLA RAITHNGRDL EGAINRLLAH SKLNAQPVTL       360
     EMAEHEVRDL IRPQEPKRIK IEDIQRVVAR QYNVSRSDLL SSRRTANVVR PRQVAMYLAK       420
     TLTLRSLPEI GRRFGGRDHT TVLHAVRKIE GLVSKDVTLS DEVESLKRQL QE               472
//

If you have problems or comments...

PBIL Back to PBIL home page