(data stored in ACNUC7421 zone)

EMBL: CP000283.PE10

CP000283.PE10        Location/Qualifiers
FT   CDS             11481..12173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0010"
FT                   /product="protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37250"
FT                   /db_xref="GOA:Q13F89"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F89"
FT                   /protein_id="ABE37250.1"
FT                   /translation="MCNLYSITKNQDAIRQIFRIARDTTGNLPPLPAIFPDGLAPIVRA
FT                   AGERELTMMRWGMPGPPQFGGIPVTNIRNTKSPHWRRWLKPENRCLVPATSFSEYNATA
FT                   NPKSLTYPDGSPHPMAGKKDVVWFALSPERPLFAFAGIWTEWTGTRGTKANPVEGAHLL
FT                   YGFLTTEPNAIVAPIHPKAMPVILTTEEERDVWMRAPWGEAAALQRPLPDGPLQIVARG
FT                   ANKEDRST"
     MCNLYSITKN QDAIRQIFRI ARDTTGNLPP LPAIFPDGLA PIVRAAGERE LTMMRWGMPG        60
     PPQFGGIPVT NIRNTKSPHW RRWLKPENRC LVPATSFSEY NATANPKSLT YPDGSPHPMA       120
     GKKDVVWFAL SPERPLFAFA GIWTEWTGTR GTKANPVEGA HLLYGFLTTE PNAIVAPIHP       180
     KAMPVILTTE EERDVWMRAP WGEAAALQRP LPDGPLQIVA RGANKEDRST                  230
//

If you have problems or comments...

PBIL Back to PBIL home page