(data stored in ACNUC7421 zone)

EMBL: CP000283.PE104

CP000283.PE104       Location/Qualifiers
FT   CDS             complement(120224..120727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0104"
FT                   /product="protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37344"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EZ5"
FT                   /protein_id="ABE37344.1"
FT                   /translation="MIRYNLRCECGHSFESWFQSSSAYDSQVRRKLVNCPACDSVKVEK
FT                   AIMAPQIVGKKGRGRAPEPAHEVAAGTAVAPQAAESPVAESATPLLLAQERELRTKLKE
FT                   LRDYIVKTADNVGDSFPNEARKMHYGDIEHRPIFGEASPAEAKALIDEGIEVAPLPVLP
FT                   EDRN"
     MIRYNLRCEC GHSFESWFQS SSAYDSQVRR KLVNCPACDS VKVEKAIMAP QIVGKKGRGR        60
     APEPAHEVAA GTAVAPQAAE SPVAESATPL LLAQERELRT KLKELRDYIV KTADNVGDSF       120
     PNEARKMHYG DIEHRPIFGE ASPAEAKALI DEGIEVAPLP VLPEDRN                     167
//

If you have problems or comments...

PBIL Back to PBIL home page