(data stored in ACNUC7421 zone)

EMBL: CP000283.PE11

CP000283.PE11        Location/Qualifiers
FT   CDS             complement(12201..13025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37251"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="InterPro:IPR008306"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F88"
FT                   /protein_id="ABE37251.1"
FT                   /translation="MKATFIGFDSAWTDNPKRPGAICSIDYDGSEFSEFRGPTLVGFKQ
FT                   ALEFIQSAYDANRLTLVAVDQPTIVNNLTGMRAAERVAAAAVSWLGGGVQPASRSRSGM
FT                   FDDNAPIWKFLRELGACDDPERCKASRDGLFIMEVFPALALPAFHPGFCGRLSAPRYNP
FT                   ARSKTFRQSDWEKVTKVVGEQVDAMQCPSFNDWCASLSSVPKPKKSDQDKLDASICLLI
FT                   ALHWMVQPRESSVMIGDLTSGYIVAPVVDEIRRRLTDKARSEYVAIDGKIPG"
     MKATFIGFDS AWTDNPKRPG AICSIDYDGS EFSEFRGPTL VGFKQALEFI QSAYDANRLT        60
     LVAVDQPTIV NNLTGMRAAE RVAAAAVSWL GGGVQPASRS RSGMFDDNAP IWKFLRELGA       120
     CDDPERCKAS RDGLFIMEVF PALALPAFHP GFCGRLSAPR YNPARSKTFR QSDWEKVTKV       180
     VGEQVDAMQC PSFNDWCASL SSVPKPKKSD QDKLDASICL LIALHWMVQP RESSVMIGDL       240
     TSGYIVAPVV DEIRRRLTDK ARSEYVAIDG KIPG                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page