(data stored in ACNUC7421 zone)

EMBL: CP000283.PE117

CP000283.PE117       Location/Qualifiers
FT   CDS             132778..133347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0117"
FT                   /product="Putative threonine efflux protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37357"
FT                   /db_xref="GOA:Q13EY2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY2"
FT                   /protein_id="ABE37357.1"
FT                   /translation="MTTQMSYEAFVLTSLLILLTPGPTNTLLAASGAAMGVRKALWLAL
FT                   AEALGYSIAISLFVAAAGALEDVPIALPLLKAVAAGWLLFSAVQLWTRPATPDRADQRG
FT                   AFSRVCVTTMLNPKAMLVGTVIIPDVTIGQAQAVLTFVVLSSVAGAGWIVSGAALPAGL
FT                   RRYSFKSAAVIIAAFSFAAAASAVQG"
     MTTQMSYEAF VLTSLLILLT PGPTNTLLAA SGAAMGVRKA LWLALAEALG YSIAISLFVA        60
     AAGALEDVPI ALPLLKAVAA GWLLFSAVQL WTRPATPDRA DQRGAFSRVC VTTMLNPKAM       120
     LVGTVIIPDV TIGQAQAVLT FVVLSSVAGA GWIVSGAALP AGLRRYSFKS AAVIIAAFSF       180
     AAAASAVQG                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page