(data stored in ACNUC7421 zone)

EMBL: CP000283.PE118

CP000283.PE118       Location/Qualifiers
FT   CDS             complement(133645..135261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0118"
FT                   /product="HWE histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37358"
FT                   /db_xref="GOA:Q13EY1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EY1"
FT                   /protein_id="ABE37358.1"
FT                   /translation="MQPPDYTFDRERLAALSRFGILDTPPERGFDDVVELTTLICETPV
FT                   ALVSFVTDDRQWFKARVGFDACQTDLNSSVCAHALIEPDLLVVPDLTIDERTKYNPLVT
FT                   GQPFIRFYAGAPLRTAGGHVLGSLCAIDTKARPGGLTAAQTSALRNLGRQVVAQLELRH
FT                   AVAQRDALLTEQKEAEIRRNGLLEIGDRLRDATSVSEMTRAAAAVVGETLGVSRAAFGR
FT                   FDEAGEYVEVEPDWTADGVVSAAGRHRLADYGPNLLRGVLNGQALVVTDVTTDPATAGH
FT                   TEALLRLDIRALVNIPVVEHGRAVAMLIVHARQPRSWSPETLTYLRNIADRIEMGVSRL
FT                   RAEAQQRILNSELSHRMKNTMALVQAVASQTLKSVPDKAPVKAFSDRLLALSMAHDVLL
FT                   QQDWRSAQVRNIVDAAICTFNEVGRFDISGEQVTLGSRAALSLALLLHELTTNAVKYGA
FT                   LSNELGRVQIAWRVETTDGDAGFRLRWNETGGPRIDPPSRRGFGSRLLGMGLSGTGDAA
FT                   LNYHRSGLEVEFTASLAELQA"
     MQPPDYTFDR ERLAALSRFG ILDTPPERGF DDVVELTTLI CETPVALVSF VTDDRQWFKA        60
     RVGFDACQTD LNSSVCAHAL IEPDLLVVPD LTIDERTKYN PLVTGQPFIR FYAGAPLRTA       120
     GGHVLGSLCA IDTKARPGGL TAAQTSALRN LGRQVVAQLE LRHAVAQRDA LLTEQKEAEI       180
     RRNGLLEIGD RLRDATSVSE MTRAAAAVVG ETLGVSRAAF GRFDEAGEYV EVEPDWTADG       240
     VVSAAGRHRL ADYGPNLLRG VLNGQALVVT DVTTDPATAG HTEALLRLDI RALVNIPVVE       300
     HGRAVAMLIV HARQPRSWSP ETLTYLRNIA DRIEMGVSRL RAEAQQRILN SELSHRMKNT       360
     MALVQAVASQ TLKSVPDKAP VKAFSDRLLA LSMAHDVLLQ QDWRSAQVRN IVDAAICTFN       420
     EVGRFDISGE QVTLGSRAAL SLALLLHELT TNAVKYGALS NELGRVQIAW RVETTDGDAG       480
     FRLRWNETGG PRIDPPSRRG FGSRLLGMGL SGTGDAALNY HRSGLEVEFT ASLAELQA         538
//

If you have problems or comments...

PBIL Back to PBIL home page