(data stored in ACNUC7421 zone)

EMBL: CP000283.PE12

CP000283.PE12        Location/Qualifiers
FT   CDS             complement(13025..15799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0012"
FT                   /product="helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37252"
FT                   /db_xref="GOA:Q13F87"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F87"
FT                   /protein_id="ABE37252.1"
FT                   /translation="MDVKPLGRSTGLVGGGNLQRFSSRLGRLSHVYLKDQLRGASEYRR
FT                   IAGYFRSSIFDLVNEEIEGIGKVRIVCNSDLDPEDINAAKQARTQLLKEKWNEVDDAVE
FT                   SFFRRPRYQRLFDILTKGNVEIRVVSRADAPFVHGKAGVIYRPDGTSSAFMGSLNETRE
FT                   GWSANYEFVWEDTSADGVAWVEDEFEYLWERGKPLPDAIIEEIGRSARRVEVQLADLTP
FT                   AEVAPAALVEADIYRKGEELMPWQRAFVSLFLEHRETYGQVRLLLADEVGVGKTLSLAG
FT                   SALVSALLGDGPVLILCPATLTAQWQIELKDRLNIPSAVWLSQEKAWLLDPDEIPMPSV
FT                   GPEGVVKCPRQIALVSTGLIFHKTEERELLMSRRYGMVILDEAHRARGKTESDEEERKA
FT                   NNLLSFMTEIAKKTTHVLLGTATPIQTDVEDMWDLLKILGMGAEHVIGDAWSEWRSTEK
FT                   VVPVITGKRKVTDDRDAWSLFRNPLPASAENEVIFGLMRGAIEMPPTRYVTQKGFSDIN
FT                   DDFCREQFIDDVLTPKGDLGFFQRNNPVVRHVVLRKRSTLEQMNLLPRIPVDIHPLPGQ
FT                   HMPALFDGLGLRTSSAFDAAYEAADKFTKVLRKRKKSAGFMRSLMLQRLCSSYASGLST
FT                   AEKLLAGRSLDDEELMLDLGPNGVELIDEERLHLQTIIDVLSPHPTDPKLDAVLYFLED
FT                   KGWLEKGCIIFSQYFDTTRWIGETLTGRLPREPVAVYAGAGKSGIYIGGEWKSVEREQI
FT                   KKAVKERTIRLVVATDAACEGLNLQTLGTLINVDLPWNPSRLEQRIGRIKRFGQRRERV
FT                   DMLNLVYHGSQQLTVDEKVYQKLSSRMKDRFDIFGTLPDVIDDDWIDDEEEFDARLNDF
FT                   TEKRKRANAFDLRYASDVDPKGERWELCEKVLARADVTKRLSRGWGERERADG"
     MDVKPLGRST GLVGGGNLQR FSSRLGRLSH VYLKDQLRGA SEYRRIAGYF RSSIFDLVNE        60
     EIEGIGKVRI VCNSDLDPED INAAKQARTQ LLKEKWNEVD DAVESFFRRP RYQRLFDILT       120
     KGNVEIRVVS RADAPFVHGK AGVIYRPDGT SSAFMGSLNE TREGWSANYE FVWEDTSADG       180
     VAWVEDEFEY LWERGKPLPD AIIEEIGRSA RRVEVQLADL TPAEVAPAAL VEADIYRKGE       240
     ELMPWQRAFV SLFLEHRETY GQVRLLLADE VGVGKTLSLA GSALVSALLG DGPVLILCPA       300
     TLTAQWQIEL KDRLNIPSAV WLSQEKAWLL DPDEIPMPSV GPEGVVKCPR QIALVSTGLI       360
     FHKTEERELL MSRRYGMVIL DEAHRARGKT ESDEEERKAN NLLSFMTEIA KKTTHVLLGT       420
     ATPIQTDVED MWDLLKILGM GAEHVIGDAW SEWRSTEKVV PVITGKRKVT DDRDAWSLFR       480
     NPLPASAENE VIFGLMRGAI EMPPTRYVTQ KGFSDINDDF CREQFIDDVL TPKGDLGFFQ       540
     RNNPVVRHVV LRKRSTLEQM NLLPRIPVDI HPLPGQHMPA LFDGLGLRTS SAFDAAYEAA       600
     DKFTKVLRKR KKSAGFMRSL MLQRLCSSYA SGLSTAEKLL AGRSLDDEEL MLDLGPNGVE       660
     LIDEERLHLQ TIIDVLSPHP TDPKLDAVLY FLEDKGWLEK GCIIFSQYFD TTRWIGETLT       720
     GRLPREPVAV YAGAGKSGIY IGGEWKSVER EQIKKAVKER TIRLVVATDA ACEGLNLQTL       780
     GTLINVDLPW NPSRLEQRIG RIKRFGQRRE RVDMLNLVYH GSQQLTVDEK VYQKLSSRMK       840
     DRFDIFGTLP DVIDDDWIDD EEEFDARLND FTEKRKRANA FDLRYASDVD PKGERWELCE       900
     KVLARADVTK RLSRGWGERE RADG                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page