(data stored in ACNUC7421 zone)

EMBL: CP000283.PE122

CP000283.PE122       Location/Qualifiers
FT   CDS             140396..140815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37362"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EX7"
FT                   /protein_id="ABE37362.1"
FT                   /translation="MHLVVCTGCREDVAQLIGNQIGSVDRWFEQRARHFVQNATDRLQR
FT                   IGVEWRGGEYDRMRVTSGAPQRGESTMRTESNRYFTIEQLEELAVAKYIEAALMPEGGE
FT                   REELLQEAKRFASRARMKSWLMGEIGITPPRREYH"
     MHLVVCTGCR EDVAQLIGNQ IGSVDRWFEQ RARHFVQNAT DRLQRIGVEW RGGEYDRMRV        60
     TSGAPQRGES TMRTESNRYF TIEQLEELAV AKYIEAALMP EGGEREELLQ EAKRFASRAR       120
     MKSWLMGEIG ITPPRREYH                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page