(data stored in ACNUC7421 zone)

EMBL: CP000283.PE132

CP000283.PE132       Location/Qualifiers
FT   CDS             complement(151611..152090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0132"
FT                   /product="protein of unknown function DUF1052"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37372"
FT                   /db_xref="GOA:Q13EW7"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EW7"
FT                   /protein_id="ABE37372.1"
FT                   /translation="MESNAVHMVLPPDLRQSETALKVARGASRLLRSLGFACVSELPLP
FT                   SGRRADLVALNERGEIWIVEIKSSVEDLRADQKWPDYRAHCDRLFFAFTQDLPCEIFPA
FT                   DTGLIVADGYGAHMHCEAPEHKLPAPTRKLMMLRFALAAAQRLNRLSDPQGFGDG"
     MESNAVHMVL PPDLRQSETA LKVARGASRL LRSLGFACVS ELPLPSGRRA DLVALNERGE        60
     IWIVEIKSSV EDLRADQKWP DYRAHCDRLF FAFTQDLPCE IFPADTGLIV ADGYGAHMHC       120
     EAPEHKLPAP TRKLMMLRFA LAAAQRLNRL SDPQGFGDG                              159
//

If you have problems or comments...

PBIL Back to PBIL home page