(data stored in ACNUC7421 zone)

EMBL: CP000283.PE14

CP000283.PE14        Location/Qualifiers
FT   CDS             complement(18758..19339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37254"
FT                   /db_xref="InterPro:IPR024220"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F85"
FT                   /protein_id="ABE37254.1"
FT                   /translation="MSERKTIGFGVPNDIDPHHFTVEIPAVRANPVIITEHFGLSGGAN
FT                   GLPDSIERCRLPQEAWNAIRRELERVFNERLKEKKLTAARWKTGKNPVERLLGRELCVL
FT                   AWGVETAPKDTIPNAIRNWGAFKPEERWWLFAMAASLTGTSQDVDIGWRKAIRIALTET
FT                   PTGEEVVAIRSKRPKSEGDRPRLPLFDDVK"
     MSERKTIGFG VPNDIDPHHF TVEIPAVRAN PVIITEHFGL SGGANGLPDS IERCRLPQEA        60
     WNAIRRELER VFNERLKEKK LTAARWKTGK NPVERLLGRE LCVLAWGVET APKDTIPNAI       120
     RNWGAFKPEE RWWLFAMAAS LTGTSQDVDI GWRKAIRIAL TETPTGEEVV AIRSKRPKSE       180
     GDRPRLPLFD DVK                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page