(data stored in ACNUC7421 zone)

EMBL: CP000283.PE141

CP000283.PE141       Location/Qualifiers
FT   CDS             complement(160419..160742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37381"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV8"
FT                   /protein_id="ABE37381.1"
FT                   /translation="MASRSAPDRAGLPGLISRSRLIAVACLVIAGAGVTTSPVSAQSCQ
FT                   ALWVERNSYYKEAGYCFKTSRAIGYFGNRGCSYDYEGDVPLSVNIRDRIAEIKAMERRF
FT                   GCN"
     MASRSAPDRA GLPGLISRSR LIAVACLVIA GAGVTTSPVS AQSCQALWVE RNSYYKEAGY        60
     CFKTSRAIGY FGNRGCSYDY EGDVPLSVNI RDRIAEIKAM ERRFGCN                     107
//

If you have problems or comments...

PBIL Back to PBIL home page