(data stored in ACNUC7421 zone)

EMBL: CP000283.PE144

CP000283.PE144       Location/Qualifiers
FT   CDS             161969..162517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37384"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV5"
FT                   /protein_id="ABE37384.1"
FT                   /translation="MKRRRNFGGRRRLPKVDGETNHNGGLSAPDEKTAALARAFDSAWE
FT                   RFIATEGAEADTDANRKRLASKIVALSRAGEADEDRLAQSGLIHLSVLAEAARLGSQPP
FT                   APTNGIGTSQQATHAQAFSPQTVAAMSAALEQCVETLPLQTPSSALQFLSARILEQASR
FT                   GEHDPERLSRHALEALRNR"
     MKRRRNFGGR RRLPKVDGET NHNGGLSAPD EKTAALARAF DSAWERFIAT EGAEADTDAN        60
     RKRLASKIVA LSRAGEADED RLAQSGLIHL SVLAEAARLG SQPPAPTNGI GTSQQATHAQ       120
     AFSPQTVAAM SAALEQCVET LPLQTPSSAL QFLSARILEQ ASRGEHDPER LSRHALEALR       180
     NR                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page