(data stored in ACNUC7421 zone)

EMBL: CP000283.PE145

CP000283.PE145       Location/Qualifiers
FT   CDS             complement(162595..163710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37385"
FT                   /db_xref="GOA:Q13EV4"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EV4"
FT                   /protein_id="ABE37385.1"
FT                   /translation="MKRFWSRYPAHWRPRRPQWGLALRITLGALLALAAAQALHLRLPL
FT                   WAVLTAIIVTQLSVGRSVKIAFDYLVGTIGGAIYGGAITILVPHSSELALLGVLALAVA
FT                   PLALLSAIKPNLNVATVTAIIVLLVPTMTQVSPLDSAIDRVLEVTVGALVGLLVSFLVL
FT                   PSRAQAQALGAAAQALDLMAVALGELLAGLIRGLDNDALHRLQDGIGAALVTLNEIGDE
FT                   AEHERATGLSRGPQMAPLIRTLLRLRHDLVMVGRAVAAPLPPPLQQRLGPCLDSFRAAA
FT                   TLHLAASASALRDRRAPPPLRAVSSALDAYAAEVQTVRQDGLTRDLSGEQAERFFALGF
FT                   AMEQLTQNFRDLEMRVAEWAARPVVETPAAV"
     MKRFWSRYPA HWRPRRPQWG LALRITLGAL LALAAAQALH LRLPLWAVLT AIIVTQLSVG        60
     RSVKIAFDYL VGTIGGAIYG GAITILVPHS SELALLGVLA LAVAPLALLS AIKPNLNVAT       120
     VTAIIVLLVP TMTQVSPLDS AIDRVLEVTV GALVGLLVSF LVLPSRAQAQ ALGAAAQALD       180
     LMAVALGELL AGLIRGLDND ALHRLQDGIG AALVTLNEIG DEAEHERATG LSRGPQMAPL       240
     IRTLLRLRHD LVMVGRAVAA PLPPPLQQRL GPCLDSFRAA ATLHLAASAS ALRDRRAPPP       300
     LRAVSSALDA YAAEVQTVRQ DGLTRDLSGE QAERFFALGF AMEQLTQNFR DLEMRVAEWA       360
     ARPVVETPAA V                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page