(data stored in ACNUC7421 zone)

EMBL: CP000283.PE163

CP000283.PE163       Location/Qualifiers
FT   CDS             complement(188553..189137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0163"
FT                   /product="protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37403"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ET6"
FT                   /protein_id="ABE37403.1"
FT                   /translation="MMKALSSPHDALPRPLAGEGWGEGDTGTELAMDDPKQPSWNVSPS
FT                   LRRHARELRKTSTDAERLMWSALRDKQLNGFSFRRQVPIGPFIADFACHSVKLVVEIDG
FT                   GQHFSDDAERADASRTALIEARGFRIVRFSNAEVMSNRDGVLQSIAAELAASAPTPTLP
FT                   RKRERERAKRAAKQRPEQIDSKQRPAAGDAD"
     MMKALSSPHD ALPRPLAGEG WGEGDTGTEL AMDDPKQPSW NVSPSLRRHA RELRKTSTDA        60
     ERLMWSALRD KQLNGFSFRR QVPIGPFIAD FACHSVKLVV EIDGGQHFSD DAERADASRT       120
     ALIEARGFRI VRFSNAEVMS NRDGVLQSIA AELAASAPTP TLPRKRERER AKRAAKQRPE       180
     QIDSKQRPAA GDAD                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page