(data stored in ACNUC7421 zone)

EMBL: CP000283.PE165

CP000283.PE165       Location/Qualifiers
FT   CDS             complement(190501..190860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0165"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37405"
FT                   /db_xref="GOA:Q13ET4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13ET4"
FT                   /protein_id="ABE37405.1"
FT                   /translation="MARVKRGVTAHAKHKKVYKLAKGFRGRRKNTIRAAKAAVDKAGQY
FT                   AFRDRKRKKRTFRALWIQRINAAVRPLGMTYSVFINGLAKSGVIVDRKVLSDLAITEPA
FT                   AFQAIAEKAKAALAA"
     MARVKRGVTA HAKHKKVYKL AKGFRGRRKN TIRAAKAAVD KAGQYAFRDR KRKKRTFRAL        60
     WIQRINAAVR PLGMTYSVFI NGLAKSGVIV DRKVLSDLAI TEPAAFQAIA EKAKAALAA        119
//

If you have problems or comments...

PBIL Back to PBIL home page