(data stored in ACNUC7421 zone)

EMBL: CP000283.PE17

CP000283.PE17        Location/Qualifiers
FT   CDS             23030..23581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37257"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F82"
FT                   /protein_id="ABE37257.1"
FT                   /translation="MTQNPSTSAWQAALVARHPNAFNVEFNGRITTPGYPSVGDGWREL
FT                   VETAVGRMVEAAAPRGSVTIVQIKEKFGGLRIYWHGRNLSAVSTRAIEEAVALAEARSA
FT                   CTCEVCGAEGRLHKHGGWFATACPEHARGDPVRVKPGFDNIRIVRSFEPGKPPILSCRR
FT                   YDRATDTFVDVDPASLGIKE"
     MTQNPSTSAW QAALVARHPN AFNVEFNGRI TTPGYPSVGD GWRELVETAV GRMVEAAAPR        60
     GSVTIVQIKE KFGGLRIYWH GRNLSAVSTR AIEEAVALAE ARSACTCEVC GAEGRLHKHG       120
     GWFATACPEH ARGDPVRVKP GFDNIRIVRS FEPGKPPILS CRRYDRATDT FVDVDPASLG       180
     IKE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page