(data stored in ACNUC7421 zone)

EMBL: CP000283.PE179

CP000283.PE179       Location/Qualifiers
FT   CDS             203618..204226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0179"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37419"
FT                   /db_xref="GOA:Q13ES0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ES0"
FT                   /protein_id="ABE37419.1"
FT                   /translation="MTIRVSGKSISVGEALRGRVSERTEEVLRKYFDGNYSGHITLSKD
FT                   GFGFRTDCSLHLDSGITLEAESNAADAYVSADQALLQIEKRLRRYKSRLKDRSSRKAHA
FT                   EATALAELTAPVDMPSYVIEAPGDEEHHEDAYNPVIIAEATTAMKRLSVSEAVVELDLT
FT                   GAPVLIFLHGGSGRVNIIYRRADGNIGWIDPPSLNGAAA"
     MTIRVSGKSI SVGEALRGRV SERTEEVLRK YFDGNYSGHI TLSKDGFGFR TDCSLHLDSG        60
     ITLEAESNAA DAYVSADQAL LQIEKRLRRY KSRLKDRSSR KAHAEATALA ELTAPVDMPS       120
     YVIEAPGDEE HHEDAYNPVI IAEATTAMKR LSVSEAVVEL DLTGAPVLIF LHGGSGRVNI       180
     IYRRADGNIG WIDPPSLNGA AA                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page