(data stored in ACNUC7421 zone)

EMBL: CP000283.PE185

CP000283.PE185       Location/Qualifiers
FT   CDS             complement(208316..209230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37425"
FT                   /db_xref="GOA:Q13ER4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER4"
FT                   /protein_id="ABE37425.1"
FT                   /translation="MTAVRAGRSRIMQKQSVFHSKFLPYMLVLPQLAVVLVFFYWPAVQ
FT                   AVIQSFLLQDAFGLSTTFVWFDNYRELLSDPDYFSAILRTFLFSVAIALSSLSLALLLA
FT                   VMADRPLRGSTFYRTLLIWPYAVAPPVVGVLWVFMLNPSLGVIAHGLRAIGIDWNPLLD
FT                   GNQAATLIILAAAWKQISYNFLFFLAGLQAIPSSVIEAAAIDGARPMRRFWTIIFPLLS
FT                   PTIFFLIVVNIVYAFFETFGIIDTMTRGGPAKATETLVYKVYSDGLLGGNLGSSAAQSV
FT                   ILMGIVIALTAFQFRFVERKVNY"
     MTAVRAGRSR IMQKQSVFHS KFLPYMLVLP QLAVVLVFFY WPAVQAVIQS FLLQDAFGLS        60
     TTFVWFDNYR ELLSDPDYFS AILRTFLFSV AIALSSLSLA LLLAVMADRP LRGSTFYRTL       120
     LIWPYAVAPP VVGVLWVFML NPSLGVIAHG LRAIGIDWNP LLDGNQAATL IILAAAWKQI       180
     SYNFLFFLAG LQAIPSSVIE AAAIDGARPM RRFWTIIFPL LSPTIFFLIV VNIVYAFFET       240
     FGIIDTMTRG GPAKATETLV YKVYSDGLLG GNLGSSAAQS VILMGIVIAL TAFQFRFVER       300
     KVNY                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page