(data stored in ACNUC7421 zone)

EMBL: CP000283.PE187

CP000283.PE187       Location/Qualifiers
FT   CDS             complement(210854..212059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0187"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37427"
FT                   /db_xref="GOA:Q13ER2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ER2"
FT                   /protein_id="ABE37427.1"
FT                   /translation="MTAALMPGAMAGLRVIDLTRVLGGPYCTQILADHGADVIKVEPPA
FT                   GDEVRDWGPPFHDDDAAYFIGINRNKRSIGLDLASPGGRDVLLEMLKDADVLIENFKPG
FT                   TLDKWGLGNDIVREKFPRLVHCRISGFGADGPRGGNPGYDAIIQAMTGMIAATGSPESG
FT                   PMRIGVPLVDITTGLYAAIGILMALSERQRSGKGQFLETTLYETGLAIMHPHTANYFLH
FT                   GKPPALTGNEHPNLVPYAIFEARDGKIFTGVGNDGTFRKLCKEIGKPELGTDPRFARNK
FT                   DRIANRAALRTELEAVFRQHDAAPLCDRLLDAGLPAGPVQSIDKALTSPHTTHRGDVIE
FT                   QDWYKGVASPIRFERTKASLRGLPPKFSQHAGEVLGEFGYSPDEISKLVADGVVSGPER
FT                   KR"
     MTAALMPGAM AGLRVIDLTR VLGGPYCTQI LADHGADVIK VEPPAGDEVR DWGPPFHDDD        60
     AAYFIGINRN KRSIGLDLAS PGGRDVLLEM LKDADVLIEN FKPGTLDKWG LGNDIVREKF       120
     PRLVHCRISG FGADGPRGGN PGYDAIIQAM TGMIAATGSP ESGPMRIGVP LVDITTGLYA       180
     AIGILMALSE RQRSGKGQFL ETTLYETGLA IMHPHTANYF LHGKPPALTG NEHPNLVPYA       240
     IFEARDGKIF TGVGNDGTFR KLCKEIGKPE LGTDPRFARN KDRIANRAAL RTELEAVFRQ       300
     HDAAPLCDRL LDAGLPAGPV QSIDKALTSP HTTHRGDVIE QDWYKGVASP IRFERTKASL       360
     RGLPPKFSQH AGEVLGEFGY SPDEISKLVA DGVVSGPERK R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page