(data stored in ACNUC7421 zone)

EMBL: CP000283.PE19

CP000283.PE19        Location/Qualifiers
FT   CDS             24633..25244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37259"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F80"
FT                   /protein_id="ABE37259.1"
FT                   /translation="MPSEFESCPMLFTNPAQRDLFVSAKSTTAIPARHPLVRDALIQAS
FT                   LDPQVRSLEFVPAATVGATQVALNAIVVVRDDGRFHLDVVEARQVRDVEMEGLFLIALD
FT                   DLKLVPLTLTADDITRQPRFANAKTVWAYRFHTVGIEMRMRVLSVLTEDGPLQLGCLLK
FT                   RTRGPRDPAPAVMALACSDLLELDIISRPLGPATMVRSRS"
     MPSEFESCPM LFTNPAQRDL FVSAKSTTAI PARHPLVRDA LIQASLDPQV RSLEFVPAAT        60
     VGATQVALNA IVVVRDDGRF HLDVVEARQV RDVEMEGLFL IALDDLKLVP LTLTADDITR       120
     QPRFANAKTV WAYRFHTVGI EMRMRVLSVL TEDGPLQLGC LLKRTRGPRD PAPAVMALAC       180
     SDLLELDIIS RPLGPATMVR SRS                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page