(data stored in ACNUC7421 zone)

EMBL: CP000283.PE190

CP000283.PE190       Location/Qualifiers
FT   CDS             complement(214271..214945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0190"
FT                   /product="protein of unknown function DUF374"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37430"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ9"
FT                   /protein_id="ABE37430.1"
FT                   /translation="MATPAFVKRILRSDAFQWTAVIPAAIYFQFVMWTGRFDRAPFPIA
FT                   EPYILAMWHGRLNMLPMLRNGSKPLVALISGHRDGQIISKAGTVFGIQTAVGSSSKGGM
FT                   RAAREMLRLARDGHSLFVTPDGPRGPRMHINNDGILDLARLTGLPILPVAVSLQRGKLL
FT                   RSWDRLMLPGLFSRVAIRFGEPVIVDADADRAEIRARLSASLTAAQQETDRLVGRIPVE
FT                   PA"
     MATPAFVKRI LRSDAFQWTA VIPAAIYFQF VMWTGRFDRA PFPIAEPYIL AMWHGRLNML        60
     PMLRNGSKPL VALISGHRDG QIISKAGTVF GIQTAVGSSS KGGMRAAREM LRLARDGHSL       120
     FVTPDGPRGP RMHINNDGIL DLARLTGLPI LPVAVSLQRG KLLRSWDRLM LPGLFSRVAI       180
     RFGEPVIVDA DADRAEIRAR LSASLTAAQQ ETDRLVGRIP VEPA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page