(data stored in ACNUC7421 zone)

EMBL: CP000283.PE194

CP000283.PE194       Location/Qualifiers
FT   CDS             219124..219429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0194"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37434"
FT                   /db_xref="GOA:Q13EQ5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ5"
FT                   /protein_id="ABE37434.1"
FT                   /translation="MIKSELVQRIAEHNPHLYQRDVENIVNAILDEIVDALARGDRVEL
FT                   RGFGAFSVKHRPARAGRNPRTGAHVPVDQKSVPFFKTGKEMRERLNREPGNTDTGA"
     MIKSELVQRI AEHNPHLYQR DVENIVNAIL DEIVDALARG DRVELRGFGA FSVKHRPARA        60
     GRNPRTGAHV PVDQKSVPFF KTGKEMRERL NREPGNTDTG A                           101
//

If you have problems or comments...

PBIL Back to PBIL home page