(data stored in ACNUC7421 zone)

EMBL: CP000283.PE195

CP000283.PE195       Location/Qualifiers
FT   CDS             219442..219855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37435"
FT                   /db_xref="GOA:Q13EQ4"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EQ4"
FT                   /protein_id="ABE37435.1"
FT                   /translation="MRGKASENDMQKFLTALVLIPLGLIFIVFAVANRHLVTVSFDPLE
FT                   PLNPMGTVQMPLFVLIIGVAILGVIAGGVATWVRQRHWRRAARRHQAEAIQAQTQLANL
FT                   RASVVTPAQSEPKRLLLGQGSAAGRRDKTSAAL"
     MRGKASENDM QKFLTALVLI PLGLIFIVFA VANRHLVTVS FDPLEPLNPM GTVQMPLFVL        60
     IIGVAILGVI AGGVATWVRQ RHWRRAARRH QAEAIQAQTQ LANLRASVVT PAQSEPKRLL       120
     LGQGSAAGRR DKTSAAL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page