(data stored in ACNUC7421 zone)

EMBL: CP000283.PE199

CP000283.PE199       Location/Qualifiers
FT   CDS             222727..223695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0199"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37439"
FT                   /db_xref="GOA:Q13EQ0"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EQ0"
FT                   /protein_id="ABE37439.1"
FT                   /translation="MNWLTNVVRPKIRNILRRETPENLWIKCPDTGQLVFYKDVEQNQF
FT                   VIPGSNYHMRMGALARLRSVFDNETWYDVALPEVTADPLKFRDERKYADRIKDARTKTG
FT                   AHDAVKVGYGKLEGLGVVAAVQDFDFMGGSLGMAAGEAIIRGLELAVEKHAPFIMFAAS
FT                   GGARMQEGILSLMQMPRTTVAVQMLREAGLPYIVVLTNPTTGGVTASYAMLGDIQLAEP
FT                   GALIGFAGARVIEQTIREKLPDGFQRAEYLRDHGMVDMVVHRHELRPTLARLCRILTKT
FT                   PLPAVEEIAASDDAAQDAEAAAATEIVVTPPEAPSPTAPQA"
     MNWLTNVVRP KIRNILRRET PENLWIKCPD TGQLVFYKDV EQNQFVIPGS NYHMRMGALA        60
     RLRSVFDNET WYDVALPEVT ADPLKFRDER KYADRIKDAR TKTGAHDAVK VGYGKLEGLG       120
     VVAAVQDFDF MGGSLGMAAG EAIIRGLELA VEKHAPFIMF AASGGARMQE GILSLMQMPR       180
     TTVAVQMLRE AGLPYIVVLT NPTTGGVTAS YAMLGDIQLA EPGALIGFAG ARVIEQTIRE       240
     KLPDGFQRAE YLRDHGMVDM VVHRHELRPT LARLCRILTK TPLPAVEEIA ASDDAAQDAE       300
     AAAATEIVVT PPEAPSPTAP QA                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page