(data stored in ACNUC7421 zone)

EMBL: CP000283.PE205

CP000283.PE205       Location/Qualifiers
FT   CDS             complement(233402..233716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0205"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37445"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EP4"
FT                   /protein_id="ABE37445.1"
FT                   /translation="MVAERNKDGRVVFERGIRAQMMAIDGTWRRPCQLEDVSEAGAKLT
FT                   VVGAVEGLNLKEFFLLLSSTGLAYRRCELSWVNGDQIGVSFLRNDKKKKPGSRTSATAA
FT                   "
     MVAERNKDGR VVFERGIRAQ MMAIDGTWRR PCQLEDVSEA GAKLTVVGAV EGLNLKEFFL        60
     LLSSTGLAYR RCELSWVNGD QIGVSFLRND KKKKPGSRTS ATAA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page