(data stored in ACNUC7421 zone)

EMBL: CP000283.PE21

CP000283.PE21        Location/Qualifiers
FT   CDS             27411..27716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F78"
FT                   /protein_id="ABE37261.1"
FT                   /translation="MLVVKIEPAPSGFVPMRRCICGLAVANVSDLADIADYRVIGGESP
FT                   NGLKNRPAGIAETMFLNHPGRHRVWALVERPCGVIMKAGWVGLSNPHFDPNFVIEI"
     MLVVKIEPAP SGFVPMRRCI CGLAVANVSD LADIADYRVI GGESPNGLKN RPAGIAETMF        60
     LNHPGRHRVW ALVERPCGVI MKAGWVGLSN PHFDPNFVIE I                           101
//

If you have problems or comments...

PBIL Back to PBIL home page