(data stored in ACNUC7421 zone)

EMBL: CP000283.PE221

CP000283.PE221       Location/Qualifiers
FT   CDS             252427..253653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0221"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37461"
FT                   /db_xref="GOA:Q13EM8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EM8"
FT                   /protein_id="ABE37461.1"
FT                   /translation="MRRVVVTGMGIVSSIGNNTQEVLASLHDAKSGISRAEKHAELGFR
FT                   SQVQGLPSLNPADVVDRRAMRFLGEGAAWNHVAMEQALADSGLEESDISNPRTGIVMGS
FT                   GGPSARTIVEAADITRTKGPKRVGPFAVPKAMSSTASATLATWFKIKGVNYSISSACAT
FT                   SNHCIGNAYELIQWGKQDVVFAGGCEELDWSLSVLFDAMGAMSSKYNDTPATASRPYDV
FT                   SRDGFVIAGGAGVLVLEELEHAKARGAKIYGEIIGYGATSDGYDMVAPSGEGAERCMKM
FT                   ALSTTGGIKIDYINPHATSTPAGDPPEINALRNVFGAGDKCPPISATKALTGHSLGATG
FT                   VQEAIYSLLMMQNGFICESANITELDPAFADMPIVRKRIDNAKIGAVLSNSFGFGGTNA
FT                   TLVFKRLDA"
     MRRVVVTGMG IVSSIGNNTQ EVLASLHDAK SGISRAEKHA ELGFRSQVQG LPSLNPADVV        60
     DRRAMRFLGE GAAWNHVAME QALADSGLEE SDISNPRTGI VMGSGGPSAR TIVEAADITR       120
     TKGPKRVGPF AVPKAMSSTA SATLATWFKI KGVNYSISSA CATSNHCIGN AYELIQWGKQ       180
     DVVFAGGCEE LDWSLSVLFD AMGAMSSKYN DTPATASRPY DVSRDGFVIA GGAGVLVLEE       240
     LEHAKARGAK IYGEIIGYGA TSDGYDMVAP SGEGAERCMK MALSTTGGIK IDYINPHATS       300
     TPAGDPPEIN ALRNVFGAGD KCPPISATKA LTGHSLGATG VQEAIYSLLM MQNGFICESA       360
     NITELDPAFA DMPIVRKRID NAKIGAVLSN SFGFGGTNAT LVFKRLDA                    408
//

If you have problems or comments...

PBIL Back to PBIL home page