(data stored in ACNUC7421 zone)

EMBL: CP000283.PE234

CP000283.PE234       Location/Qualifiers
FT   CDS             complement(272520..273308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0234"
FT                   /product="protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37474"
FT                   /db_xref="GOA:Q13EL5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EL5"
FT                   /protein_id="ABE37474.1"
FT                   /translation="MTDPIADPVVPDTLAEPRLVVEPGVAARFAAVAEPVLQAMGYRLV
FT                   RIKVSGEAGCTVQIMAERPDGTMLIDDCEAVSRALSPVLDVTDPIDRAYRLEISSPGID
FT                   RPLVRSSDFARYSGHLVKIEMAVPHQGRKRYRGLLDGVEGDAIRIQREGVTKDEDPLVL
FT                   LPMHDIGDARLVLTDELVAESMRRGKQAERELKQSLGLAPPPPPHAKRSDPKKSSAPKP
FT                   KPLTKPVVKPDAKPKPKNTKQHRLAADRLRRGDTDLSEGD"
     MTDPIADPVV PDTLAEPRLV VEPGVAARFA AVAEPVLQAM GYRLVRIKVS GEAGCTVQIM        60
     AERPDGTMLI DDCEAVSRAL SPVLDVTDPI DRAYRLEISS PGIDRPLVRS SDFARYSGHL       120
     VKIEMAVPHQ GRKRYRGLLD GVEGDAIRIQ REGVTKDEDP LVLLPMHDIG DARLVLTDEL       180
     VAESMRRGKQ AERELKQSLG LAPPPPPHAK RSDPKKSSAP KPKPLTKPVV KPDAKPKPKN       240
     TKQHRLAADR LRRGDTDLSE GD                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page