(data stored in ACNUC7421 zone)

EMBL: CP000283.PE240

CP000283.PE240       Location/Qualifiers
FT   CDS             complement(279055..279642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0240"
FT                   /product="protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37480"
FT                   /db_xref="GOA:Q13EK9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EK9"
FT                   /protein_id="ABE37480.1"
FT                   /translation="MPQSNAGGRSDCIGAARDSSFGPMSSSAIPATEVVIAADCWQAEA
FT                   SAESVVLRAIEAAATMIDADTGDAELAVMLTDDDGVRALNASYRGIDKPTNVLSFPAPQ
FT                   PDYQDACQDSGGAPQMLGDIAIAYQTVRREADDEGKPFAHHLSHLAVHGFLHLVGYDHE
FT                   TDAEAETMESTERSILAGLGIPDPYADQDRVS"
     MPQSNAGGRS DCIGAARDSS FGPMSSSAIP ATEVVIAADC WQAEASAESV VLRAIEAAAT        60
     MIDADTGDAE LAVMLTDDDG VRALNASYRG IDKPTNVLSF PAPQPDYQDA CQDSGGAPQM       120
     LGDIAIAYQT VRREADDEGK PFAHHLSHLA VHGFLHLVGY DHETDAEAET MESTERSILA       180
     GLGIPDPYAD QDRVS                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page