(data stored in ACNUC7421 zone)

EMBL: CP000283.PE241

CP000283.PE241       Location/Qualifiers
FT   CDS             complement(279642..280697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0241"
FT                   /product="PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37481"
FT                   /db_xref="GOA:Q13EK8"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK8"
FT                   /protein_id="ABE37481.1"
FT                   /translation="MAKSASDSSSLISRRKLERDSQTPPETQVVVAFDDNRAASALVGP
FT                   YGQHLAQIERRLAVVVDSRGNHITIAGARESCDSARRVLETLYAQAVSGSDISQGDVDG
FT                   AIRAVIAQGSLFEFDSKPAAGVFEAINLRKRPVRARTAAQDSYIRALKRHELVFGVGPA
FT                   GTGKTWLAVAHAAQLFERKEVDKIILTRPAVEAGERLGFLPGDLREKVDPYLRPIYDAL
FT                   YDLMDSRIVERALQTNEIEIAPLAFMRGRTLTNAAIILDEAQNTTSMQMKMFLTRLGEN
FT                   SRMIVTGDPSQVDLPNGQTSGLSEAVRLLSGVEGIAQVKFTAEDVIRHELVARIVAAYE
FT                   GAPPKPAGGAA"
     MAKSASDSSS LISRRKLERD SQTPPETQVV VAFDDNRAAS ALVGPYGQHL AQIERRLAVV        60
     VDSRGNHITI AGARESCDSA RRVLETLYAQ AVSGSDISQG DVDGAIRAVI AQGSLFEFDS       120
     KPAAGVFEAI NLRKRPVRAR TAAQDSYIRA LKRHELVFGV GPAGTGKTWL AVAHAAQLFE       180
     RKEVDKIILT RPAVEAGERL GFLPGDLREK VDPYLRPIYD ALYDLMDSRI VERALQTNEI       240
     EIAPLAFMRG RTLTNAAIIL DEAQNTTSMQ MKMFLTRLGE NSRMIVTGDP SQVDLPNGQT       300
     SGLSEAVRLL SGVEGIAQVK FTAEDVIRHE LVARIVAAYE GAPPKPAGGA A                351
//

If you have problems or comments...

PBIL Back to PBIL home page