(data stored in ACNUC7421 zone)

EMBL: CP000283.PE242

CP000283.PE242       Location/Qualifiers
FT   CDS             complement(280703..282124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0242"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37482"
FT                   /db_xref="GOA:Q13EK7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EK7"
FT                   /protein_id="ABE37482.1"
FT                   /translation="MAPPRKLHIKSYGCQMNVYDAQRMVDVLAPEGFVETATVDDADLV
FT                   ILNTCHIREKASEKVYSELGRLRLARDEAASSGRRMQIAVAGCVAQAEGEEIVRRAPVV
FT                   DVVVGPQSYHHLPQLLARADQAGRALETEFPVEDKFGFLPQPRPETIRARGISAFVTVQ
FT                   EGCDKFCTFCVVPYTRGAEVSRPVSAIIDDVKRLADNGVREITLIGQNVNAYHGEGPDS
FT                   RAWTLGRLLRRLAAVPGIVRLRYSTSHPNDVDDELIEAHRDLDALMPFVHLPVQSGSDP
FT                   ILAAMNRKHTAADYRRVIDRFRAVRPQIAFSSDFIVGFPGETEADFAATLALVTQIGYA
FT                   GAYSFKYSPRPGTPAADMQEMVPAAVMDERLERLQQLIDSQQSAFNKAAIGQTVDVLFE
FT                   RAGRKPGQIVGRTAYLQPAHVFPGPMFLGPGMAPDSLVGQILPVRVDSLERYSLLGELA
FT                   AKPPQHARPLAATGA"
     MAPPRKLHIK SYGCQMNVYD AQRMVDVLAP EGFVETATVD DADLVILNTC HIREKASEKV        60
     YSELGRLRLA RDEAASSGRR MQIAVAGCVA QAEGEEIVRR APVVDVVVGP QSYHHLPQLL       120
     ARADQAGRAL ETEFPVEDKF GFLPQPRPET IRARGISAFV TVQEGCDKFC TFCVVPYTRG       180
     AEVSRPVSAI IDDVKRLADN GVREITLIGQ NVNAYHGEGP DSRAWTLGRL LRRLAAVPGI       240
     VRLRYSTSHP NDVDDELIEA HRDLDALMPF VHLPVQSGSD PILAAMNRKH TAADYRRVID       300
     RFRAVRPQIA FSSDFIVGFP GETEADFAAT LALVTQIGYA GAYSFKYSPR PGTPAADMQE       360
     MVPAAVMDER LERLQQLIDS QQSAFNKAAI GQTVDVLFER AGRKPGQIVG RTAYLQPAHV       420
     FPGPMFLGPG MAPDSLVGQI LPVRVDSLER YSLLGELAAK PPQHARPLAA TGA              473
//

If you have problems or comments...

PBIL Back to PBIL home page