(data stored in ACNUC7421 zone)

EMBL: CP000283.PE245

CP000283.PE245       Location/Qualifiers
FT   CDS             complement(283463..283948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0245"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37485"
FT                   /db_xref="GOA:Q13EK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EK4"
FT                   /protein_id="ABE37485.1"
FT                   /translation="MMTWLAEFWGYADALVEPATLSDSPKLAQLHAASFHSGWSEEEFA
FT                   DLLSQRNTLVHRLRMGRRIIGFIASRFGADEAEILSVAVASGYRGRGLSRELLLTHLGH
FT                   LAGRGVAKVFLEVEENNQPARRLYQRSGFEIVGRRERYYRQPDGEQLNALIMRRDLS"
     MMTWLAEFWG YADALVEPAT LSDSPKLAQL HAASFHSGWS EEEFADLLSQ RNTLVHRLRM        60
     GRRIIGFIAS RFGADEAEIL SVAVASGYRG RGLSRELLLT HLGHLAGRGV AKVFLEVEEN       120
     NQPARRLYQR SGFEIVGRRE RYYRQPDGEQ LNALIMRRDL S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page