(data stored in ACNUC7421 zone)

EMBL: CP000283.PE25

CP000283.PE25        Location/Qualifiers
FT   CDS             29997..32429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0025"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37265"
FT                   /db_xref="GOA:Q13F74"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F74"
FT                   /protein_id="ABE37265.1"
FT                   /translation="MSMEQSFEPHVPLIRLHKNDQVVIDEVWYRETHRTKHAVTLHPIG
FT                   GTLPRVFTGRQLRELYFDPAKRMRIVRGPNEKLDPEVAAAASRPFESFSAGQQAEMLKR
FT                   YDYVLACDRFFARKLFTKRPETGYARIAEIVARYRRLVRAHQENRPSCRFDLETVGGST
FT                   LRDWYGRWLHSGRQLGALAPLLHSRGSKEKKMDPAVRALIADCVNEKYLTAEAPPLTVV
FT                   WDYICGRIDDLNEDGRHALAKPSEMAVRRWIKDNVDPFTEVFYRKGRKKATHQFRLTNN
FT                   APLATRPLQIVEFDETPLDIMLVDDNGKNPRRAVLTAGICVATGMIVGWHIGYEHPSWV
FT                   TVMKALRMAVLAKDTSGSGAESPYPVYGVPEMIKVDNGPAYRSHSLVAAAGQLQFEIRL
FT                   CPVAKPNLKGKVERFFREVTRDFLSIFPGRTFSNIQERGDYDSEGNARMTLQTVQRLFT
FT                   RWVVDIYHNRPNSRCFGQTPLERWEALSGFGVRVPPQSDDLTPLIGLIVNRTIQADGIT
FT                   FMGLTYRDAALKLMRQKSHMGREWMVKIDPNDLRWIYILNDEAQCWVRAGCQRADLIEG
FT                   LSLKMWMEVVKAAKEATAARQRVSIATLRRARVALLREAEAMGNKPHGKITARDQMWIE
FT                   ANMNQPAYLISVDPDELDAMPNRMLPRRRAKPAENEAKRDPSMVEPASRAGGHPIADQD
FT                   LPDAPLDVAERELDDEVREQQERDDLRQWRKRAAALSSAVSTTQKTDAQPLRTVTEAAP
FT                   PIIPDQQEDVSQARQEAPVGAFERLATAACTRTPTRLADEDDIESWNPNNDQKEIDQ"
     MSMEQSFEPH VPLIRLHKND QVVIDEVWYR ETHRTKHAVT LHPIGGTLPR VFTGRQLREL        60
     YFDPAKRMRI VRGPNEKLDP EVAAAASRPF ESFSAGQQAE MLKRYDYVLA CDRFFARKLF       120
     TKRPETGYAR IAEIVARYRR LVRAHQENRP SCRFDLETVG GSTLRDWYGR WLHSGRQLGA       180
     LAPLLHSRGS KEKKMDPAVR ALIADCVNEK YLTAEAPPLT VVWDYICGRI DDLNEDGRHA       240
     LAKPSEMAVR RWIKDNVDPF TEVFYRKGRK KATHQFRLTN NAPLATRPLQ IVEFDETPLD       300
     IMLVDDNGKN PRRAVLTAGI CVATGMIVGW HIGYEHPSWV TVMKALRMAV LAKDTSGSGA       360
     ESPYPVYGVP EMIKVDNGPA YRSHSLVAAA GQLQFEIRLC PVAKPNLKGK VERFFREVTR       420
     DFLSIFPGRT FSNIQERGDY DSEGNARMTL QTVQRLFTRW VVDIYHNRPN SRCFGQTPLE       480
     RWEALSGFGV RVPPQSDDLT PLIGLIVNRT IQADGITFMG LTYRDAALKL MRQKSHMGRE       540
     WMVKIDPNDL RWIYILNDEA QCWVRAGCQR ADLIEGLSLK MWMEVVKAAK EATAARQRVS       600
     IATLRRARVA LLREAEAMGN KPHGKITARD QMWIEANMNQ PAYLISVDPD ELDAMPNRML       660
     PRRRAKPAEN EAKRDPSMVE PASRAGGHPI ADQDLPDAPL DVAERELDDE VREQQERDDL       720
     RQWRKRAAAL SSAVSTTQKT DAQPLRTVTE AAPPIIPDQQ EDVSQARQEA PVGAFERLAT       780
     AACTRTPTRL ADEDDIESWN PNNDQKEIDQ                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page