(data stored in ACNUC7421 zone)

EMBL: CP000283.PE250

CP000283.PE250       Location/Qualifiers
FT   CDS             complement(287292..288848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0250"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37490"
FT                   /db_xref="GOA:Q13EJ9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ9"
FT                   /protein_id="ABE37490.1"
FT                   /translation="MIRPILTVSAGTLSSRLLGFVRDALVAALLGAGVVADAFLLAFQL
FT                   VNVARRLLTEGALNAALVPAWLRVREHNGAVAAAAYAGRLLGTVALATLLLALLLGVFM
FT                   PLLIALLAPGFVGHPTLLMATRDARLMLPYLAFAGPVAVMMGLFNAQGKVGLTAFSPLL
FT                   FNVALIVVTAALLLWHANDTQAALILSATIGVAGLMQLGIVVFNGRGERLATPLRASFD
FT                   PSMRAFFAKAIPGMIANSGPQLLIVIGAIVASSKPSAVSWLYFANRLIELPLGIVGVAM
FT                   GAVLVPELARAVRGDDRAALSDAASRGLELAIGVALPAMLGLIVLREPIVRVLFEHGAF
FT                   TASDTAATALALGLLALGLPAQVLAKTWSAAFFAREDTSTPLFATLVALGVALAAALLL
FT                   GRTYGASGVAAAIALGAWSNAALLLGRGLARFGVAIDPAARRRVALIVLAAGAMGGLLW
FT                   LKAGFVLPLVAEASTLAQAAVLGVLIAGGLIIYAALLILFGVVRPAAALGALRRPRGLR
FT                   G"
     MIRPILTVSA GTLSSRLLGF VRDALVAALL GAGVVADAFL LAFQLVNVAR RLLTEGALNA        60
     ALVPAWLRVR EHNGAVAAAA YAGRLLGTVA LATLLLALLL GVFMPLLIAL LAPGFVGHPT       120
     LLMATRDARL MLPYLAFAGP VAVMMGLFNA QGKVGLTAFS PLLFNVALIV VTAALLLWHA       180
     NDTQAALILS ATIGVAGLMQ LGIVVFNGRG ERLATPLRAS FDPSMRAFFA KAIPGMIANS       240
     GPQLLIVIGA IVASSKPSAV SWLYFANRLI ELPLGIVGVA MGAVLVPELA RAVRGDDRAA       300
     LSDAASRGLE LAIGVALPAM LGLIVLREPI VRVLFEHGAF TASDTAATAL ALGLLALGLP       360
     AQVLAKTWSA AFFAREDTST PLFATLVALG VALAAALLLG RTYGASGVAA AIALGAWSNA       420
     ALLLGRGLAR FGVAIDPAAR RRVALIVLAA GAMGGLLWLK AGFVLPLVAE ASTLAQAAVL       480
     GVLIAGGLII YAALLILFGV VRPAAALGAL RRPRGLRG                               518
//

If you have problems or comments...

PBIL Back to PBIL home page