(data stored in ACNUC7421 zone)

EMBL: CP000283.PE256

CP000283.PE256       Location/Qualifiers
FT   CDS             complement(295704..296390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37496"
FT                   /db_xref="GOA:Q13EJ3"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EJ3"
FT                   /protein_id="ABE37496.1"
FT                   /translation="MRRAVGLALGLLLTAAPAHAQDSATLKKDMVGQWELSTTERSKTC
FT                   VVTLKPDAAPRGMKLELEPGCAAALPFTRDIAAWTVKGLDIVRLETAAGDPVIDFTEVE
FT                   SGIFEGLRANEGVYILQNLAAARSLAKSMEQMIGDWSMVRGSGRPICSLTLTNNEASTP
FT                   DNFQAFLKPRCEPPVAGFGPTMWRLERGALLLTAPSGEIWRFEADDNAQWRKTPDTADP
FT                   LIMLRQ"
     MRRAVGLALG LLLTAAPAHA QDSATLKKDM VGQWELSTTE RSKTCVVTLK PDAAPRGMKL        60
     ELEPGCAAAL PFTRDIAAWT VKGLDIVRLE TAAGDPVIDF TEVESGIFEG LRANEGVYIL       120
     QNLAAARSLA KSMEQMIGDW SMVRGSGRPI CSLTLTNNEA STPDNFQAFL KPRCEPPVAG       180
     FGPTMWRLER GALLLTAPSG EIWRFEADDN AQWRKTPDTA DPLIMLRQ                    228
//

If you have problems or comments...

PBIL Back to PBIL home page