(data stored in ACNUC7421 zone)

EMBL: CP000283.PE26

CP000283.PE26        Location/Qualifiers
FT   CDS             32426..33565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37266"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F73"
FT                   /protein_id="ABE37266.1"
FT                   /translation="MSRAIQKGSVVSLETALPAKASKPAVCGQPRKGPEEDAMRPQPRR
FT                   DVRSKNPSRNARADRLKGLSDVAVRTGKLAVAEQMFDELVVAYYSKVEGNLMVVYGSSG
FT                   SGKTHVLRQLRKDEDLQLDETDPECARRPLLMIEAPSPCTLKTLGLAVLQGLGYEEAGF
FT                   ANLREHEVWRRARANLSNQGTGILVIDEMHNVLAGRSNMESVKIAMTLKSLMVSEVTPI
FT                   QIVISGLKTVRDFAEHFKELQRRSQFLEMTPLTSPRDDKKLVLFLEGLEKELKFRTCGF
FT                   TRHDLPVRFMMASRGLIGRVAYFVKMAAKLAITLGDDEIKQEYLGKVYERIYRVSANQN
FT                   PFLMANVASFVMPREKEADELTFVRGVKEVSRRNGDAAD"
     MSRAIQKGSV VSLETALPAK ASKPAVCGQP RKGPEEDAMR PQPRRDVRSK NPSRNARADR        60
     LKGLSDVAVR TGKLAVAEQM FDELVVAYYS KVEGNLMVVY GSSGSGKTHV LRQLRKDEDL       120
     QLDETDPECA RRPLLMIEAP SPCTLKTLGL AVLQGLGYEE AGFANLREHE VWRRARANLS       180
     NQGTGILVID EMHNVLAGRS NMESVKIAMT LKSLMVSEVT PIQIVISGLK TVRDFAEHFK       240
     ELQRRSQFLE MTPLTSPRDD KKLVLFLEGL EKELKFRTCG FTRHDLPVRF MMASRGLIGR       300
     VAYFVKMAAK LAITLGDDEI KQEYLGKVYE RIYRVSANQN PFLMANVASF VMPREKEADE       360
     LTFVRGVKEV SRRNGDAAD                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page