(data stored in ACNUC7421 zone)

EMBL: CP000283.PE263

CP000283.PE263       Location/Qualifiers
FT   CDS             303023..304009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37503"
FT                   /db_xref="GOA:Q13EI6"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI6"
FT                   /protein_id="ABE37503.1"
FT                   /translation="MPQLQDFRTGKPAFYPDQAIYAEYACARLGLRFSERDGGTGLLFA
FT                   VASGTKEICFGGGRCSYYPQNNATAASLATDKYLANALLERAGVATLGGRYFFLHDRHR
FT                   ALRPPGHERKDALDYLAAQGGHAFAKPLTGSRGDFARPIESAAALASYLDDVARYYDSV
FT                   LIQPYASGHEYRVFVVDGEALYTARKLPPAVIGDGVRSLRELLHEHDRALRDRGLSGAS
FT                   GDDPSLDQVPAAGERRDIAGRMNLSVGGAMVMEEAGAPAIAGARAATRALGLRLGAVDL
FT                   FVDPDARDDVRVIEVNSNPAIRFLESCGRDDLIVAIWRHSLTAAGLL"
     MPQLQDFRTG KPAFYPDQAI YAEYACARLG LRFSERDGGT GLLFAVASGT KEICFGGGRC        60
     SYYPQNNATA ASLATDKYLA NALLERAGVA TLGGRYFFLH DRHRALRPPG HERKDALDYL       120
     AAQGGHAFAK PLTGSRGDFA RPIESAAALA SYLDDVARYY DSVLIQPYAS GHEYRVFVVD       180
     GEALYTARKL PPAVIGDGVR SLRELLHEHD RALRDRGLSG ASGDDPSLDQ VPAAGERRDI       240
     AGRMNLSVGG AMVMEEAGAP AIAGARAATR ALGLRLGAVD LFVDPDARDD VRVIEVNSNP       300
     AIRFLESCGR DDLIVAIWRH SLTAAGLL                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page