(data stored in ACNUC7421 zone)

EMBL: CP000283.PE267

CP000283.PE267       Location/Qualifiers
FT   CDS             307917..308537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0267"
FT                   /product="protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37507"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI2"
FT                   /protein_id="ABE37507.1"
FT                   /translation="MQTVHTEVTMGLLDILNGMQNGPRGPADPNDKSGGMSKFTMAILA
FT                   LLAYKAYKHVTAPDAPASVGHGRPTSVPQSPNTMPSRNTINAGMPGGGLSDMLKGGLGG
FT                   LLAGGAAGTILSGGLGDLMKQFQTNGLGDAADSWVGRGENKQIGPNDLANALGADRLEM
FT                   LTQQTGMSREELLDGLSQQLPGVIDQLTPDGRLPTEDEASRWI"
     MQTVHTEVTM GLLDILNGMQ NGPRGPADPN DKSGGMSKFT MAILALLAYK AYKHVTAPDA        60
     PASVGHGRPT SVPQSPNTMP SRNTINAGMP GGGLSDMLKG GLGGLLAGGA AGTILSGGLG       120
     DLMKQFQTNG LGDAADSWVG RGENKQIGPN DLANALGADR LEMLTQQTGM SREELLDGLS       180
     QQLPGVIDQL TPDGRLPTED EASRWI                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page