(data stored in ACNUC7421 zone)

EMBL: CP000283.PE268

CP000283.PE268       Location/Qualifiers
FT   CDS             308588..308866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0268"
FT                   /product="Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37508"
FT                   /db_xref="GOA:Q13EI1"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EI1"
FT                   /protein_id="ABE37508.1"
FT                   /translation="MTGILWIILVGFIAGIIARFLSPGPNNPQGFLLTTVLGIVGAFLA
FT                   TAIGQAIGHYGPNQGAGFITATIGAVLVLFIWNRLVARRVLSDPGNR"
     MTGILWIILV GFIAGIIARF LSPGPNNPQG FLLTTVLGIV GAFLATAIGQ AIGHYGPNQG        60
     AGFITATIGA VLVLFIWNRL VARRVLSDPG NR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page