(data stored in ACNUC7421 zone)

EMBL: CP000283.PE27

CP000283.PE27        Location/Qualifiers
FT   CDS             33552..35345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37267"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F72"
FT                   /protein_id="ABE37267.1"
FT                   /translation="MLPTSPHRNVGEGAIGFLMRLGETHGVRKFCDMLRDLGIRRFDLS
FT                   QGIGVDRVARAAMVARAALQFDSGTRTRQGVMLRGELLRPRQWSVHAGRRGCPACFAGD
FT                   RDGTVLPRQWHRAWWDIRAVTVCPLHGLLLIDACPRCGVPLDFKVNAIGQCRNGHPLWD
FT                   SSPERVTGFAGDEYIVGRLVGSDRIPNSLLDAGRLGEAIDALDLVGRCVLAGHHTGGSG
FT                   GLRRHVVLAAGFECFIDWPAAFDPLLDGLLRSSKQGVGKWGAAAAYGPLHYGLQELGCG
FT                   RIAMEMKAHLRRHAAANGVSISKPVFGTVPNVTGIYSVRHAARRFGMGFEGTRTLLARE
FT                   GVVPEETRRGTPIRISTAVVDRLATERSLTVGLGRLADHLALGRGQTRRLVGAGFLGDR
FT                   RPRPSLADADAMLAKLCIGAPANWDRSETASLPDACRSARCSIEVAVRSILAGAPDVKG
FT                   YRPGAGLRGIFVRVSDLRAVGKLSRGRLTLADAAAALRVKWETARALAADGLLVTADDG
FT                   VHPSALDNFQRDFIAAADLAKVARVRSQSLIKQLSGMGVSPAAGPPNCRQVFYRRSSLR
FT                   AVRALRRKLPGVYARALGQSR"
     MLPTSPHRNV GEGAIGFLMR LGETHGVRKF CDMLRDLGIR RFDLSQGIGV DRVARAAMVA        60
     RAALQFDSGT RTRQGVMLRG ELLRPRQWSV HAGRRGCPAC FAGDRDGTVL PRQWHRAWWD       120
     IRAVTVCPLH GLLLIDACPR CGVPLDFKVN AIGQCRNGHP LWDSSPERVT GFAGDEYIVG       180
     RLVGSDRIPN SLLDAGRLGE AIDALDLVGR CVLAGHHTGG SGGLRRHVVL AAGFECFIDW       240
     PAAFDPLLDG LLRSSKQGVG KWGAAAAYGP LHYGLQELGC GRIAMEMKAH LRRHAAANGV       300
     SISKPVFGTV PNVTGIYSVR HAARRFGMGF EGTRTLLARE GVVPEETRRG TPIRISTAVV       360
     DRLATERSLT VGLGRLADHL ALGRGQTRRL VGAGFLGDRR PRPSLADADA MLAKLCIGAP       420
     ANWDRSETAS LPDACRSARC SIEVAVRSIL AGAPDVKGYR PGAGLRGIFV RVSDLRAVGK       480
     LSRGRLTLAD AAAALRVKWE TARALAADGL LVTADDGVHP SALDNFQRDF IAAADLAKVA       540
     RVRSQSLIKQ LSGMGVSPAA GPPNCRQVFY RRSSLRAVRA LRRKLPGVYA RALGQSR          597
//

If you have problems or comments...

PBIL Back to PBIL home page