(data stored in ACNUC7421 zone)

EMBL: CP000283.PE28

CP000283.PE28        Location/Qualifiers
FT   CDS             35342..37240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37268"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F71"
FT                   /protein_id="ABE37268.1"
FT                   /translation="MNVINRSTAVRRPLACRGPLWTDEPAYARANRLALMNGINSLASF
FT                   GGEMRIPYRQIIWGWRNAEIAALAGMDPANLGAVTFRVGDDDRVRLGDEVLHIDDWSYN
FT                   VLRVCPACLRSDFERESRFPDLLPHIRSWWNLDAIEVCPLHRTPLLGGNPDIFGHRNDP
FT                   KILDVRFVAGVDCDLSSLQVEVGIVEDVRAESYILGRLGFMPRVRSEILDDLPLWNAIR
FT                   LMDRFGAVAAAGVRGFTSLGGSVSKREALSAGYAVFADGKDGLFCLLDRLVADADVARG
FT                   KWGPRVAYGRIYEWLSHDTREEAYDPVRELVRQHAIDNIPMAAGDLVFDRPIGDRHVFT
FT                   LWHVSRELKTTPSATRRILKAMGHLSPDDDVKENWQVLLRKPVVDQVTADLADWLGFNE
FT                   ARALLGLPRAPMDALLQSGVLKAFLSVSTGVAEHIFRRRDLDAFMTSLVGGAPFSRKTE
FT                   GLCDVVQAGRRSGTSTTDVVAALLAGRLTCCGRLSSATGMMQVLVDIEAVRALRASGEV
FT                   RRPGMTVEDARRKLGVTWPVVSNLIGLGLIKTIETRAGPKNRKQSFIEDSELEAFTAEF
FT                   VSATEIAEARKTHVRVLVPALRKQGIEPAIEKTAVGQYFYTREKFTLSRAVVESEH"
     MNVINRSTAV RRPLACRGPL WTDEPAYARA NRLALMNGIN SLASFGGEMR IPYRQIIWGW        60
     RNAEIAALAG MDPANLGAVT FRVGDDDRVR LGDEVLHIDD WSYNVLRVCP ACLRSDFERE       120
     SRFPDLLPHI RSWWNLDAIE VCPLHRTPLL GGNPDIFGHR NDPKILDVRF VAGVDCDLSS       180
     LQVEVGIVED VRAESYILGR LGFMPRVRSE ILDDLPLWNA IRLMDRFGAV AAAGVRGFTS       240
     LGGSVSKREA LSAGYAVFAD GKDGLFCLLD RLVADADVAR GKWGPRVAYG RIYEWLSHDT       300
     REEAYDPVRE LVRQHAIDNI PMAAGDLVFD RPIGDRHVFT LWHVSRELKT TPSATRRILK       360
     AMGHLSPDDD VKENWQVLLR KPVVDQVTAD LADWLGFNEA RALLGLPRAP MDALLQSGVL       420
     KAFLSVSTGV AEHIFRRRDL DAFMTSLVGG APFSRKTEGL CDVVQAGRRS GTSTTDVVAA       480
     LLAGRLTCCG RLSSATGMMQ VLVDIEAVRA LRASGEVRRP GMTVEDARRK LGVTWPVVSN       540
     LIGLGLIKTI ETRAGPKNRK QSFIEDSELE AFTAEFVSAT EIAEARKTHV RVLVPALRKQ       600
     GIEPAIEKTA VGQYFYTREK FTLSRAVVES EH                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page