(data stored in ACNUC7421 zone)

EMBL: CP000283.PE282

CP000283.PE282       Location/Qualifiers
FT   CDS             complement(324975..325856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37522"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EG7"
FT                   /protein_id="ABE37522.1"
FT                   /translation="MNIPVSRPSRRQAHASLMPGLIAGLLTIGLASIAPLDRAAAQGKL
FT                   DARYEATLAGIEVGKGGWVIEITDDGYAAAANGATSGVLQAFSRGNGSGEAQGRLVNGQ
FT                   FSPMNYMATTTSAKKTETIRITLANGNVKESSIEPEQPHDADRIPVTEAHRRGVVDPMT
FT                   GSILRVPGVGDLISPDSCRVSTPIFDGRMRYDLRMDYKRIETVKAEKGYQGPVLVCGIY
FT                   FTPVSGYIPDRAAIKYLVEQRGMEVWLAPIAGTRMLVPFRLKIPTPLGNAVLQATQFVT
FT                   KATPPKSVSRTQ"
     MNIPVSRPSR RQAHASLMPG LIAGLLTIGL ASIAPLDRAA AQGKLDARYE ATLAGIEVGK        60
     GGWVIEITDD GYAAAANGAT SGVLQAFSRG NGSGEAQGRL VNGQFSPMNY MATTTSAKKT       120
     ETIRITLANG NVKESSIEPE QPHDADRIPV TEAHRRGVVD PMTGSILRVP GVGDLISPDS       180
     CRVSTPIFDG RMRYDLRMDY KRIETVKAEK GYQGPVLVCG IYFTPVSGYI PDRAAIKYLV       240
     EQRGMEVWLA PIAGTRMLVP FRLKIPTPLG NAVLQATQFV TKATPPKSVS RTQ              293
//

If you have problems or comments...

PBIL Back to PBIL home page