(data stored in ACNUC7421 zone)

EMBL: CP000283.PE283

CP000283.PE283       Location/Qualifiers
FT   CDS             326169..326474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0283"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37523"
FT                   /db_xref="GOA:Q13EG6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13EG6"
FT                   /protein_id="ABE37523.1"
FT                   /translation="MSRRCELTAKGVQTGHKVSHSNIKTKRRFLPNLVNVTFLSDALGR
FT                   PVRLRVSTNALKSVDHRGGLDAFLAKASIAELSPKAAELKRAIAKKKAGEPAAAAS"
     MSRRCELTAK GVQTGHKVSH SNIKTKRRFL PNLVNVTFLS DALGRPVRLR VSTNALKSVD        60
     HRGGLDAFLA KASIAELSPK AAELKRAIAK KKAGEPAAAA S                           101
//

If you have problems or comments...

PBIL Back to PBIL home page